Press Release Forum [pressreleaseforum.com] Forum Index

Press Release Forum [pressreleaseforum.com]
Free Press Release Distribution

A site of EPR Network

 FAQFAQ   SearchSearch   MemberlistMemberlist   UsergroupsUsergroups   RegisterRegister 
 ProfileProfile   Log in to check your private messagesLog in to check your private messages   Log inLog in 

Real Time Press Release Distribution is here. Try it out, it's free!

 

AnaSpec Introduces New Cys-Containing b-Amyloid Peptides

 
Post new topic   Reply to topic    Press Release Forum [pressreleaseforum.com] Forum Index -> Biotech Press Releases
View previous topic :: View next topic  
Author Message
anaspec



Joined: 15 Aug 2006
Posts: 238
Location: 34801 Campus Drive, Fremont, CA 94555

PostPosted: Mon Oct 19, 2009 6:00 pm    Post subject: AnaSpec Introduces New Cys-Containing b-Amyloid Peptides Reply with quote

Fremont, CA – October 19, 2009

The hallmark of Alzheimer’s disease (AD) pathology includes b-sheet aggregates of b-amyloid peptides in senile plaques and hyperphosphorylated tau protein in neurofibrillary tangles (NFT).1-2 Recent publications have reported the use of Cys-containing mutants as models for aggregation studies.3-5 Shivaprasad and Wetzel employ “the use of disulfide bond cross-linking to probe the fold within the core and the packing interactions between beta-sheets.” Among the Cys mutants they studied is the S26C (Ser substituted with Cys at position 26).3 Upon oxidation of the S26C monomer, cysteines are capable of forming intermolecular disulfide bond creating the S26C dimer.3-4 Using this synthetic dimer, Hu, et al. show that it behaves similarly to b-amyloid dimer-containing human CSF, suggesting that Ab dimers may be the earliest synaptic disrupting species in AD.4

The supplier of the world’s largest collection of b-amyloid GO™ (catalog) Peptides, AnaSpec has added the following amyloid peptides to its selection: b-amyloid (1-40) S26C; b-amyloid (1-42) S26C dimer; b-amyloid (1-42) S26C and other Cys-containing b-amyloid peptides (Cys on the N or C-terminus as well as in the internal sequence).

Besides using these Cys-containing b-amyloid peptides for dimerization, the availability of the Cysteine’s thiol group also allows researchers the flexibility of reacting these peptides with any maleimide containing fluorescent dyes or biomolecules. For example, the thiol group of Cys-b-amyloid (1-40) can react with HiLyte Fluor™ 488, C2 maleimide to form HiLyte Fluor™ 488-Cys-b-amyloid (1-40) [Cys(HiLyte Fluor™ 488)-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV].

References:
1. Khachaturian, ZS. Arch. Neurol. 42, 1097 (1985).
2. Mirra, SS. et al. Neurol. 41, 479 (1991).
3. Shivaprasad, S. and R. Wetzel. J. Biol. Chem. 281, 993 (2006).
4. Hu, N-W. et al. Brain doi:10.1093/brain/awn174.
5. Shankar, GM. et al. Nat. Med. 14, 837 (2008).

About AnaSpec

AnaSpec is a leading provider of integrated proteomics solutions to the world’s largest biotech, pharmaceutical, and academic research institutions. With a vision for innovation through synergy, AnaSpec focuses on three core technologies: peptides, detection reagents, and antibodies.

For more information visit www.anaspec.com

###
_________________
Ping Yang
Marketing Speialist
34801 Campus Drive
Fremont, CA 94555
1-800-452-5530 (Toll free)
1-510-791-9560 (Tel)
1-510-791-9572 (Fax)
ping@anaspec.com
www.anaspec.com
Back to top
View user's profile Send private message Send e-mail Visit poster's website
Display posts from previous:   
Post new topic   Reply to topic    Press Release Forum [pressreleaseforum.com] Forum Index -> Biotech Press Releases All times are GMT - 4 Hours
Page 1 of 1

 
Jump to:  
You cannot post new topics in this forum
You cannot reply to topics in this forum
You cannot edit your posts in this forum
You cannot delete your posts in this forum
You cannot vote in polls in this forum

Submit Press Release (Free)Submit Press Release