Press Release Forum [pressreleaseforum.com] Forum Index

Press Release Forum [pressreleaseforum.com]
Free Press Release Distribution

A site of EPR Network

 FAQFAQ   SearchSearch   MemberlistMemberlist   UsergroupsUsergroups   RegisterRegister 
 ProfileProfile   Log in to check your private messagesLog in to check your private messages   Log inLog in 

Real Time Press Release Distribution is here. Try it out, it's free!

 

AnaSpec Introduces Thirteen New Catalog Peptides

 
Post new topic   Reply to topic    Press Release Forum [pressreleaseforum.com] Forum Index -> Biotech Press Releases
View previous topic :: View next topic  
Author Message
anaspec



Joined: 15 Aug 2006
Posts: 238
Location: 34801 Campus Drive, Fremont, CA 94555

PostPosted: Fri May 18, 2007 6:48 pm    Post subject: AnaSpec Introduces Thirteen New Catalog Peptides Reply with quote

San Jose, CA – May 18, 2007

This week AnaSpec, one of the world’s largest providers of custom and catalog peptides, introduced thirteen (13) new peptides for drug discovery research.

Helodermin (Cat# 61867-05)
Helodermin was originaly isolated from the venom of the lizard Heloderma suspectum. It is a secretin/VIP-related peptide with sequence similarities to Vasoactive Intestinal Peptide (VIP); Growth Hormone-Releasing Factor (GRF); and peptide histidine-isoleucin (PHI).
Sequence: HSDAIFTQQYSKLLAKLALQKYLASILGSRTSPPP
Sequence (3-Letter): H-His-Ser-Asp-Ala-Ile-Phe-Thr-Gln-Gln-Tyr-Ser-Lys-Leu-Leu-Ala-Lys-Leu-Ala-Leu-Gln-Lys-Tyr-Leu-Ala-Ser-Ile-Leu-Gly-Ser-Arg-Thr-Ser-Pro-Pro-Pro-OH
Reference(s): Vandermeeers, A. et al. Eur. J. Biochem. 164, 321 (1987); Dejda, A. et al. Pol. J. Pharmacol. 55, 747 (2003).

Activity-Dependent Neurotrophic Factor; ADNF (Cat# 61929)
Activity-dependent neurotrophic factor (ADNF) is a nine amino acid peptide originally purified from conditioned medium of astrocytes. ADNF protects neurons from death induced by beta-Amyloid at extremely low concentrations.
Sequence: SALLRSIPA
Sequence (3-Letter): H-Ser-Ala-Leu-Leu-Arg-Ser-Ile-Pro-Ala-OH
Reference(s): Chiba, T. et al. J. Neurosci. 25, 10252 (2005); D.Brenneman and I.Gozes J. Clin. Invest. 97, 2299 (1996).

Beta-Amyloid (10-35) (Cat# 61931)
This is an experimentally defined model peptide for the fibril formation from the core residues of the beta-Amyloid peptides of Alzheimer's disease. This peptide adopts the structure of an extended parallel beta-sheet at pH 7.4 in high-resolution structural studies.
Sequence: YEVHHQKLVFFAEDVGSNKGAIIGLM
Sequence (3-Letter): H-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-OH
Reference(s): Lakdawala, A. et al. Am. Chem. Soc. 124, 15150 (2002); Benzinger, S. et al. Biochem. 39, 3491 (2000); Trzesniewska, K.et al. Acta Neurobiol. Exp. 64, 41 (2004).

Angiotensin II Receptor; AT2; Amino Terminal Fragment (Cat# 61901)
This peptide is derived from the amino terminus of the rat Angiotensin II; Ang II; AT2 receptor. Ang II plays a major role in the regulation of blood pressure and fluid; and electrolyte balance.
Sequence: MKDNFSFAATSRNITSS
Sequence (3-Letter): H-Met-Lys-Asp-Asn-Phe-Ser-Phe-Ala-Ala-Thr-Ser-Arg-Asn-Ile-Thr-Ser-Ser-OH
Reference(s): Ozono, R. et al. Hypertens. 30, 1238 (1997); Wang, Z. et al. Hypertens. 33, 96 (1999).

Nuclear Export Signal; NES p53 (Cat# 61883)
This peptide is a nuclear export signal (NES) that regulates subcellular localization and nuclear-cytoplasmic shuttling of p53. Appropriate subcellular localization is crucial for regulating p53 function. p53 export is mediated by this highly conserved leucine-rich nuclear export signal located in its tetramerization domain. Mutation of NES residues prevents p53 export and hampers tetramer formation.
Sequence: FRELNEALELKD
Sequence (3-Letter): H-Phe-Arg-Glu-Leu-Asn-Glu-Ala-Leu-Glu-Leu-Lys-Asp-OH
Reference(s): Turner, J. et al. J. Cell Sci. 117, 3061 (2004); M. Ashcroft and K. Vousden Oncogene 18, 7637 (1999); Stommel, J. et al. EMBO J. 18, 1660 (1999).

Nuclear Export Signal; NES MAPKK (Cat# 61888)
This peptide is a functional nuclear export signal (NES) of mitogen-activated protein kinase kinase (MAPKK); a classical NES peptide.
Sequence: ALQKKLEELELD
Sequence (3-Letter): H-Ala-Leu-Gln-Lys-Lys-Leu-Glu-Glu-Leu-Glu-Leu-Asp-OH
Reference(s): Kawamori, D. et al. Diab. 52, 2896 (2003); Gadal, O. et al. Mol. Cell. Biol. 21, 3405 (2001).

Nuclear Export Signal; NES HIV Rev (Cat# 61890)
This peptide is a functional nuclear export signal (NES) of the human immunodeficiency virus Rev protein.
Sequence: LQLPPLERLTLD
Sequence (3-Letter): H-Leu-Gln-Leu-Pro-Pro-Leu-Glu-Arg-Leu-Thr-Leu-Asp-OH
Reference(s): Kawamori, D. et al. Diab. 52, 2896 (2003); Gadal, O. et al. Mol. Cell. Biol. 21, 3405 (2001).

Activated Protein C (390-404); human (Cat# 61862)
The peptide region containing residues 390-404 in Activated Protein C (APC) is essential for anticoagulant activity and is available for interaction with antibodies or with other proteins; such as the macromolecular substrates Factors Va or VIIIa. APC regulates blood coagulation by proteolytic inactivation of the blood coagulation cofactors Va and VIIIa.
Sequence: YGVYTKVSRYLDWIH
Sequence (3-Letter): H-Tyr-Gly-Val-Tyr-Thr-Lys-Val-Ser-Arg-Tyr-Leu-Asp-Trp-Ile-His-OH
Reference(s): Yegneswaran, S. J. Biol. Chem. 278, 33312 (2003); Mesters, R. et al. J. Biol. Chem. 266, 24514 (1991).

Translation Initiation Factor 2B; pS13; FAM-labeled (Cat# 61740)
This is a FAM-labeled single phosphorylated amidated peptide corresponding to the translation initiation factor e-subunit of 2B (eIF2B). It is selective for GSK3 and therefore useful for measuring GSK3 activity in cell extracts that may contain other Ser/Thr kinases. The references below correspond to the non-labeled peptide.
Sequence: 5-FAM-RRAAEELDSRAG-pS-PQL-NH2
Sequence (3-Letter): 5-FAM-Arg-Arg-Ala-Ala-Glu-Glu-Leu-Asp-Ser-Arg-Ala-Gly-pSer-Pro-Gln-Leu-NH2
Reference(s): Oreña, S. et al. J. Biol. Chem. 275, 15765 (2000); Kang Ho Kim, et al. J. Biol. Chem. 279, 51999 (2004); Nikoulina, S. et al. Diabetes 51, 2190 (2002); Brady, M. et al. J. Biol. Chem. 273, 14063 (1998).

Doc-6 (130-145) (Cat# 61894)
This peptide is a sequence from fragment 130 to 145 of Doc-6. Dok-6; a novel member of the Dok-4/5 subclass of the p62Dok family that can associate with receptor tyrosine kinase (Ret) and also serves as a substrate of the Ret signaling cascade. Dok-6 expression in vivo overlaps significantly with that of Ret. Dok family members are modular docking proteins consisting of an N-terminal pleckstrin homology (PH) domain; a central PTB domain; and a variable C-terminal region. A complete sequence of Doc-6 can be found in the reference listed below.
Sequence: GVQREQNERFNVYLMP
Sequence (3-Letter): H-Gly-Val-Gln-Arg-Glu-Gln-Asn-Glu-Arg-Phe-Asn-Val-Tyr-Leu-Met-Pro-OH
Reference(s): Crowder, R. et al. J. Biol. Chem. 279, 42072 (2004).

Pannexin-1 Fragment (4512) (Cat# 61903)
This is a pannexin-1 fragment used in generating anti-pannexin-1 antibody. Antibody 4512 is directed against this peptide sequence located in the putative first extracellular loop of pannexin 1. Pannexins represent a recently discovered second family of gap junction proteins in vertebrates. Pannexin 1also forms nonjunctional membrane channels that provide a passageway from the cytoplasm to the extracellular space for molecules in the size range of second messengers. Pannexin channels could mediate ATP-induced ATP release.
Sequence: VQQKSSLQSESGN
Sequence (3-Letter): H-Val-Gln-Gln-Lys-Ser-Ser-Leu-Gln-Ser-Glu-Ser-Gly-Asn-OH
Reference(s): Locovei, S. et al. PNAS 103, 7655 (2006).

Pannexin-1 Fragment (4515) (Cat# 61904)
This is a Pannexin-1 fragment used in generating anti-pannexin-1 antibody. Antibody 4515 was directed against carboxyl-terminal amino acids. Pannexins represent a recently discovered second family of gap junction proteins in vertebrates. Pannexin 1; in addition to forming gap junctions in paired oocytes; also forms nonjunctional membrane channels that provide a passageway from the cytoplasm to the extracellular space for molecules in the size range of second messengers. Pannexin-1 forms a stress-sensitive; ATP-permeable channel.
Sequence: EKNSRQRLLNPS
Sequence (3-Letter): H-Glu-Lys-Asn-Ser-Arg-Gln-Arg-Leu-Leu-Asn-Pro-Ser-OH
Reference(s): Locovei, S. et al. PNAS 103, 7655 (2006).

Invertebrate Tachykinin-I; OctTK-I (Cat# 61933)
This novel invertebrate tachikinin-like peptide (Inv-TK) OctTK-I with C-terminal consensus motif F-X-GLM-NH2 was characterized from salivary gland of Octopus vulgaris. It displays structural and functional similarities with vertebrate tachykinins.
Sequence: KPPSSSEFIGLM-NH2
Sequence (3-Letter): H-Lys-Pro-Pro-Ser-Ser-Ser-Glu-Phe-Ile-Gly-Leu-Met-NH2
Reference(s): Satake, H. et al. Zool. Sci. 20, 533 (2003); Kanda, A. et al. Pept. 24, 35 (2003).

For more information visit www.anaspec.com

Company Info
AnaSpec, Inc. is a leading provider of integrated proteomics solutions to pharmaceutical, biotech, and academic research institutions throughout the world. With a vision for innovation through synergy, AnaSpec focuses on three core technologies: peptides, detection reagents, and combinatorial chemistry. Established in 1993, AnaSpec's headquarters and manufacturing facilities are located in San Jose, CA.
_________________
Ping Yang
Marketing Speialist
34801 Campus Drive
Fremont, CA 94555
1-800-452-5530 (Toll free)
1-510-791-9560 (Tel)
1-510-791-9572 (Fax)
ping@anaspec.com
www.anaspec.com
Back to top
View user's profile Send private message Send e-mail Visit poster's website
Display posts from previous:   
Post new topic   Reply to topic    Press Release Forum [pressreleaseforum.com] Forum Index -> Biotech Press Releases All times are GMT - 4 Hours
Page 1 of 1

 
Jump to:  
You cannot post new topics in this forum
You cannot reply to topics in this forum
You cannot edit your posts in this forum
You cannot delete your posts in this forum
You cannot vote in polls in this forum

Submit Press Release (Free)Submit Press Release