Press Release Forum [pressreleaseforum.com] Forum Index

Press Release Forum [pressreleaseforum.com]
Free Press Release Distribution

A site of EPR Network

 FAQFAQ   SearchSearch   MemberlistMemberlist   UsergroupsUsergroups   RegisterRegister 
 ProfileProfile   Log in to check your private messagesLog in to check your private messages   Log inLog in 

Real Time Press Release Distribution is here. Try it out, it's free!

 

AnaSpec Introduces Thirty-Two New Catalog Peptides

 
Post new topic   Reply to topic    Press Release Forum [pressreleaseforum.com] Forum Index -> Biotech Press Releases
View previous topic :: View next topic  
Author Message
anaspec



Joined: 15 Aug 2006
Posts: 238
Location: 34801 Campus Drive, Fremont, CA 94555

PostPosted: Fri Sep 14, 2007 6:13 pm    Post subject: AnaSpec Introduces Thirty-Two New Catalog Peptides Reply with quote

September 13, 2007 – San Jose, CA

Today AnaSpec, one of the world’s largest providers of custom and catalog peptides, introduced thirty-two (32) new peptides for drug discovery research.

Beta-Amyloid A4 Protein Precursor (740-770); APP (C31) - Cat# 62073
This 31-amino acid peptide C31 corresponds to the C-terminal fragment of the Amyloid Precursor Protein (APP). Caspase cleavage of amyloid beta-protein precursor with the generation of C31 may be involved in the neuronal death associated with Alzheimer disease. The resultant C31 peptide is a potent inducer of apoptosis. This peptide is located in lipid rafts together with the APP-BP1; a binding protein for the intracellular domain of APP.
Sequence: AAVTPEERHLSKMQQNGYENPTYKFFEQMQN

Amyloid Precursor Protein (APP) (667-676) - Cat# 62065
This amyloid precursor protein fragment amino acid residues 667 to 676 is a beta secretase substrate. This peptide may be also cleaved by Beta-site APP cleavage enzyme (BACE) between Met and Asp residues; and by the enzyme thimet oligopeptidase (TOP).
Sequence: SEVKMDAEFR

Amyloid Precursor Protein (APP) (667-676); Dnp-labeled - Cat# 62074
This amyloid precursor protein fragment amino acid residues 667 to 676 is a beta secretase substrate labeled with DAP(Dnp). This peptide may be used in beta secretase activity assays.
Sequence: SEVKMDAEFR-DAP(DNP)-KK

[Ala10]-beta-Amyloid (1-10) - Cat# 62131
This is the N-terminal fragment of the b-Amyloid peptide; residues 1 to 10; modified with alanine substitution at position 10.
Sequence: DAEFRHDSGA-NH2

[Cys9]-beta-Amyloid (1-9) - Cat# 62132
This is the N-terminal fragment of the b-Amyloid peptide; residues 1 to 8; with cysteine coupled at position 9. A cysteine residue is coupled to the b-Amyloid peptide for antibody development purposes.
Sequence: DAEFRHDSC

Beta-Amyloid (16-20) M - Cat# 61344
This membrane permeable N-methyl amino acid-containing peptide inhibits b-amyloid 1 to 40 fibrillogenesis. Its structure is remarkably stable to changes in solvent conditions and resists denaturation by heating; changes in pH (from 2.5 to 10.5); and addition of denaturants such as urea and guanindine-HCl. The striking water solubility; in combination with the hydrophobic composition of the peptide; allows the peptide to pass spontaneously through cell membranes.
Sequence: Ac-K(Me)-L-(N-Me-V)-FF-NH2

Beta-Amyloid (14-23) - Cat# 62024
This sequence is crucial for fibril formation of the full-length beta -Amyloid peptides. beta -Amyloid 14 to 23 fibrils contain antiparallel beta-sheets with a registry of backbone hydrogen bonds that connects residue 17+k of each peptide molecule with residue 22-k of neighboring molecules in the same beta-sheet. In general; beta sheets involving the peptides with this essential fragment sequence strongly prefer the anti-parallel topology.
Sequence: HQKLVFFAED

Beta-Amyloid (1-16); Lys16(HiLyte Fluor TM 488) - Cat# 62002-05
This peptide is the b-Amyloid peptide; residues 1 to 16 labeled with HiLyte Fluor TM 488 on the Lys16; Abs/Em =501/527.
Sequence: DAEFRHDSGYEVHHQ-K(HiLyte Fluor 488)

Beta-Amyloid (15–36) - Cat# 62023
This is a fragment of beta-amyloid peptide amino acids 15 to 36. As a part of the full length b-amyloid peptide; fragment 15 to 36 adopts an alpha-helical conformation between these 15 and 36 residues with a kink or hinge at 25 to 27 according to some authors; and 15 to 20 and 24 to 34 by others.
Sequence: QKLVFFAEDVGSNKGAIIGLMV

[Cys58]105Y; Cell Penetrating Peptide; ?1-antitrypsin (358-374) - Cat# 62005
This is a synthetic peptide based on the sequence corresponding to residues 359 to 374 of ?1-antitrypsin. C105Y can penetrate cell membrane rapidly; enter the cytoplasm; and localize to the nucleus and nucleolus of live culture cells. C105Y peptide is routed to the nucleolus very rapidly in an energy-dependent fashion; whereas membrane translocation and nuclear localization are energy-independent. It enhances gene expression from DNA nanoparticles.
Sequence: CSIPPEVKFNKPFVYLI

GRP10; Gastrin-releasing Peptide 10 / Neuromedin C; amidated - Cat# 62095
This sequence is shared by the Gastrin-releasing peptide (GRP) and / Neuromedin C fragments. GRP is a small; naturally occurring bombesin-like peptide. Isolated from canine antral muscle; this peptide was also used as a part of the antigen-antibody complex to rapidly identify antigenic determinants (epitopes).
Sequence: GNHWAVGHLM-NH2

M1128; Viral Matrix Protein (128-135) - Cat# 62031
This peptide is a matrix protein fragment; residues 128 to 135; a Kb-restricted epitope M1128. This peptide binds Kb with high affinity and induces CTLs that effectively recognize influenza PR8-infected cells.
Sequence: MGLIYNRM

R18 Peptide - Cat# 62160
R18 is a peptide that specifically binds to 14-3-3 proteins without isoform selectivity. 14-3-3 proteins are known to regulate a variety of different cellular processes; such as cell division; apoptosis; signaling; carbon and nitrogen metabolism. They were the first proteins recognized to specifically bind a discrete phosphoserine or phosphothreonine motif. 14-3-3 proteins belong to a conserved protein family consisting of seven isoforms in human; two isoforms in yeast (Saccharomyces cerevisiae); 15 isoforms in Arabidopsis (Arabidopsis thaliana); and eight isoforms in rice.
Sequence: PHCVPRDLSWLDLEANMCLP

RIAD; FAM labeled - Cat# 62018
This cell-soluble high affinity-binding peptide; the RI anchoring disruptor (RIAD) selectively uncouples cAMP-mediated inhibition of T cell function and inhibits progesterone synthesis at the mitochondria in steroid-producing cells. These processes are controlled by the type I PKA holoenzyme and RIAD; and can be used as a tool to define anchored type I PKA signaling events.
Sequence: LEQYANQLADQIIKEATE-K(FAM)-NH2

PKC zeta 410 - Cat# 62025
PKC-zeta is a critical mediator of mitogenic signaling in many cell types; mediating angiotensin II–induced activation of extracellular signal-regulated kinases (ERK) and cell proliferation in vascular smooth muscle cells; insulin-induced ERK activation in adipocytes. PKC-z is mediated by phosphorylation at its T-loop site by 3-phosphoinositide–dependent protein kinase-1 (PDK1) followed by autophosphorylation. PDK-1 and its downstream target; Thr-410 in the activation loop of PKC-z is required for insulin-stimulated glucose transport. PKC-z also mediates phospholipase D activation.
Sequence: GDTTSTFCGTPN

Heat Shock Protein 65 (458-474); human - Cat# 62035
This sequence is a T-cell epitope of hsp65; 65-kDa heat shock protein molecule fragment. This peptide is important in pathogenesis of diabetes. Diabetogenic T-cell clones recognizing this peptide mediate insulitis and hyperglycemia.
Sequence: NEDQKIGIEIIKRTLKI

Obestatin (11-23); human - Cat# 62041
This peptide is 11 to 23 amino acids fragment of the rat and mouse obestatin peptide. Derived from the ghrelin gene; obestatin peptide suppresses food intake; inhibits jejunal contraction; and decreases body-weight gain. Obestatin was thought to bind to the orphan G protein–coupled receptor GPR39; however new data confirm that I125-obestatin does not bind GPR39.
Sequence: LSGVQYQQHSQAL

PyCSP (57–70) Plasmodium Yoelii Circumsporozoite Protein (57–70) - Cat# 62130
This peptide causes CD4+ T cell proliferation and cytokine responses. P. Yoelii (Py) infects laboratory mice and has provided a useful model for studying antimalarial immunity. This peptide was used in the malaria vaccine development studies.
Sequence: KIYNRNIVNRLLGD

Cathepsin D substrate; fluorogenic - Cat# 61860-05
This is the peptide substrate for cathepsin D; a lysosomal aspartic proteinase that has been implicated in several pathological processes such as breast cancer and Alzheimer's disease; Abs/Em=335/493 nm.
Sequence: Ac-E-D(edans)-KPILFFRLG-K(dabcyl)-E-NH2

EYK(EYA)3EYK - Cat# 62218
This synthetic polypeptide is a critical residue in P18 sequence required for Ag/I- Ad induced activation of T cell hybridoma A.1.1. It was positively tested for its ability to act as a target for the A.1.1-derived suppressive activity when conjugated to SRBC (sheep erythrocyte).
Sequence: EYKEYAEYAEYAEYK

PDGF-BB peptide - Cat# 62192
This Platelet-derived Growth Factor-BB (PDGF-BB) peptide fragment was used in the stellate cells research. PDGF is a dimeric peptide composed of two closely related; but not identical chains; A and B; which are linked by disulfide bonds. PDGF regulates its biological functions through its binding to specific high-affinity receptors on cell surface. The PDGF alpha-receptor binds PDGF-AA and PDGF-BB; whereas the Beta-receptor (PDGFR-beta) binds PDGF-BB only. PDGF is one of the growth factors that regulates cell growth and division.
Sequence: CSRNLIDC (S-S BONDED)

Alpha-Myosin (735-747) - Cat# 62124
This peptide belongs to the cardiac a-myosin amino acid residues 735 to 747. Immunization with cardiac myosin induces T cell-mediated myocarditis in genetically predisposed mice and serves as a model for autoimmune heart disease.
Sequence: GQFIDSGKAGAEKL

Alpha-Myosin (947-960) - Cat# 62125
This peptide belongs to the cardiac Alpha-myosin amino acid residues 947 to 960. Immunization with cardiac myosin induces T cell-mediated myocarditis in genetically predisposed mice and serves as a model for autoimmune heart disease. Myocarditis induced by this a-myosin peptide was restricted to foci of interstitial infiltration.
Sequence: DECSELKKDIDDLE

Alpha-Myosin (614-643) - Cat# 62126
This peptide belongs to the acetylated cardiac alpha-myosin amino acid residues 614 to 643. Immunization with cardiac myosin induces T cell-mediated myocarditis in genetically predisposed mice and serves as a model for autoimmune heart disease. The nonacetylated variant of this dominant peptide corresponding to amino acids 614 to 643 fails to induce the disease. N-terminal acetylation significantly changes the pathogenicity of the peptides. This acetylated form of the peptide shows dominant pathogenicity and induces severe myocarditis with inflammatory lesions throughout the ventricular wall.
Sequence: Ac-SLKLMATLFSTYASADTGDSGKGKGGKKKG

Alpha-Myosin (614-643) Modified - Cat# 62127
This peptide belongs to the modified acetylated cardiac alpha-myosin. Immunization with cardiac alpha-myosin induces T cell-mediated myocarditis in genetically predisposed mice and serves as a model for autoimmune heart disease. Alpha-Myosin is the immunodominant isoform and induces myocarditis at high severity and prevalence whereas beta-myosin and modified alpha-myosin do not.
Sequence: Ac-SLKLLSNLFANYAGADTAPVDKGKGKAKKG

Apidaecin IA - Cat# 62045
Apidaecin IA is unique antibacterial peptide derivative found in immune honey bee lymph. Apidaecins; the most prominent components of the honey bee humoral defense against microbial invasion; are a series of small; proline-rich 18- to 20-residue peptides. They inhibit viability of Gram-negative bacteria; with lethal activity near immediate; independent of a conventional 'lytic' mechanism; and involves stereoselective recognition of target molecules.
Sequence: GNNRPVYIPQPRPPHPRI

Andropin - Cat# 62046
Andropin; which encodes an antibacterial protein; shows no direct homology with most cecropins; but is closely linked to the Cecropin gene cluster of D. melanogaster.
Sequence: VFIDILDKVENAIHNAAQVGIGFAKPFEKLINPK

Apidaecin IB - Cat# 62044
Apidaecin IB is an insect antimicrobial peptide showing a significant sequence homology and a common mechanism of action with drosocin; but is devoid of any pore-forming activity. Apidaecins are the most prominent components of the honey bee humoral defense against microbial invasion.
Sequence: GNNRPVYIPQPRPPHPRL

VEGFR-2/KDR I; murine - Cat# 62090
This peptide is the murine Vascular Endothelial Growth Factor Receptor 2(VEGFR-2)/KDR fragment I that binds murine MHC Class I molecules and elicits an anti-angiogenic immune response. It is an angiogenesis inhibitor. VEGFR2/KDR plays a crucial role in tumor-associated angiogenesis and vascularization. Immunization with this peptide effectively reduces angiogenesis and inhibits tumor growth in mouse models.
Sequence: FSNSTNDILI

TP53 Q9NP68; p53 Mutant Form (361-377); Lys371 (Ac) - Cat# 62121
This peptide is derived from the tumor suppressor p53 mutant with the acetylated Lys on the side chain.
Sequence: KKGQSTSRHK-K(Ac)-LMFKTEG

Bid BH3-R9 - Cat# 62057
Tagging peptides with a poly-D-arginine tag facilitates cell internalization in vitro and in vivo. Poly-D-arginine was tagged to the Bid BH3; which is a pro-apoptotic member of the 'BH3-only' subset of the BCL-2 family proteins that constitute a critical control point in apoptosis.
Sequence: RRRRRRRRGEDIIRNIARHLAQVGDSMDR

Bak-BH3 peptide; Mca labeled - Cat# 62029
This peptide is derived from the BH3 domain of Bak (Flu-BakBH3).It has high-affinity binding to a surface pocket of the Bcl-XL protein that is essential for its death antagonist function. This peptide is labeled with MCA (7-methoxycoumarine-4-yl)acetyl on the N-terminus; Abs/Em=325/393 nm.
Sequence: 7-methoxycoumarine-4-yl acetyl (Mca)-GQVGRQLAIIGDDINR

Company Info
AnaSpec, Inc. is a leading provider of integrated proteomics solutions to pharmaceutical, biotech, and academic research institutions throughout the world. With a vision for innovation through synergy, AnaSpec focuses on three core technologies: peptides, detection reagents, and combinatorial chemistry. Established in 1993, AnaSpec's headquarters and manufacturing facilities are located in San Jose, CA.

For more information visit www.anaspec.com
_________________
Ping Yang
Marketing Speialist
34801 Campus Drive
Fremont, CA 94555
1-800-452-5530 (Toll free)
1-510-791-9560 (Tel)
1-510-791-9572 (Fax)
ping@anaspec.com
www.anaspec.com
Back to top
View user's profile Send private message Send e-mail Visit poster's website
Display posts from previous:   
Post new topic   Reply to topic    Press Release Forum [pressreleaseforum.com] Forum Index -> Biotech Press Releases All times are GMT - 4 Hours
Page 1 of 1

 
Jump to:  
You cannot post new topics in this forum
You cannot reply to topics in this forum
You cannot edit your posts in this forum
You cannot delete your posts in this forum
You cannot vote in polls in this forum

Submit Press Release (Free)Submit Press Release